PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.001G030600.2
Common NameB456_001G030600, LOC105766286
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family ARR-B
Protein Properties Length: 660aa    MW: 72307.8 Da    PI: 5.6108
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.001G030600.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like91.29.2e-29202255155
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         kpr++W+ eLH++Fv av++L G +kA+Pk+il+lm+v+gLt+e+v+SHLQkYRl
  Gorai.001G030600.2 202 KPRVVWSVELHRKFVAAVNHL-GLDKAVPKKILDLMNVEGLTRENVASHLQKYRL 255
                         79*******************.********************************8 PP

2Response_reg80.27e-27201281109
                         EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHH CS
        Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalea 89 
                         vl vdD+p+ +++l ++l k +y +v+++ ++ +al++l+e++  +Dl++ D++mp+mdG++ll+     e++lp+i+++ah++ +++ + 
  Gorai.001G030600.2  20 VLAVDDDPICLKVLGTLLLKCQY-QVTTTNQAISALKMLRENRnrYDLVISDVNMPDMDGFKLLELVGL-EMDLPVIMLSAHSDTKLVMKG 108
                         799********************.***************999889*******************87754.558****************** PP

                         HHTTESEEEESS--HHHHHH CS
        Response_reg  90 lkaGakdflsKpfdpeelvk 109
                         +  Ga d+l Kp+ +eel +
  Gorai.001G030600.2 109 ITHGACDYLLKPVRIEELKN 128
                         *****************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0363922.3E-1701658IPR017053Response regulator B-type, plant
Gene3DG3DSA:3.40.50.23002.6E-4217172No hitNo description
SuperFamilySSF521722.28E-3517141IPR011006CheY-like superfamily
SMARTSM004488.3E-3318130IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011043.78119134IPR001789Signal transduction response regulator, receiver domain
PfamPF000722.6E-2420128IPR001789Signal transduction response regulator, receiver domain
CDDcd001563.59E-2821133No hitNo description
SuperFamilySSF466897.17E-20199259IPR009057Homeodomain-like
PROSITE profilePS5129412.375199258IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.9E-30200260IPR009057Homeodomain-like
TIGRFAMsTIGR015574.5E-25202255IPR006447Myb domain, plants
PfamPF002492.5E-7204254IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 660 aa     Download sequence    Send to blast
MGGSNREDEA LDRFPVGMRV LAVDDDPICL KVLGTLLLKC QYQVTTTNQA ISALKMLREN  60
RNRYDLVISD VNMPDMDGFK LLELVGLEMD LPVIMLSAHS DTKLVMKGIT HGACDYLLKP  120
VRIEELKNIW QHVVRRKKPD SKDRVNALNQ DKASGGIGEA VQTSTSSSDQ KFNKKRKDQN  180
EDEEDDGEDN EHENDDPSTQ KKPRVVWSVE LHRKFVAAVN HLGLDKAVPK KILDLMNVEG  240
LTRENVASHL QKYRLYLKRL SSVATQQANM VAALGGKDPS YLRMGSLDGF GDFRTLTGSG  300
RLSSATLSSY QPSGMFGRLN SSAALNLRGI SSGVIQQGHP QTLSNSINGL GKIQPVGLPA  360
NQNQNGTLFQ GIPTSIELNQ LLQNKSANHF GELNPVNNPN VFGVATNFPD ARMTVGSSSS  420
SLSTPSGSPL LLQANTQQAQ RSGAFGNQSS LDVASLNQES FDMGVHGFSN FVDNGRCHEN  480
WQNTVQLSSF PSNSLSTCEA FSHEQLHTNN LQESISWRSS HLNDNPIDLS ASMANAGLED  540
SRGDMQCQIS PSNNVIHNID YAAKQQWGEN SSFAGVDSLV AGAPYVQHLE AGKLAFNTKL  600
RSNEDILFEQ RKPQNEFSQN NFETLDVISS PMIKPEQYNE TGMMEGELGY DAFPLGSCI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A5e-26198261164ARR10-B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHQ5251072e-67HQ525107.1 Gossypium herbaceum clone NBRI_A_EYI1BW401BL3EZ simple sequence repeat marker, mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012441162.10.0PREDICTED: two-component response regulator ARR12-like
SwissprotQ6K8X61e-147ORR23_ORYSJ; Two-component response regulator ORR23
TrEMBLA0A0D2PU230.0A0A0D2PU23_G
STRINGVIT_11s0206g00060.t010.0(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G25180.11e-130response regulator 12
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]